Tesamorelin and Ipamorelin Blend (8mg)

Description

Tesamorelin  Ipamorelin Blend Product Description

The Tesamorelin Ipamorelin Blend combines Tesamorelin, a synthetic growth hormone-releasing hormone (GHRH) analog, with Ipamorelin, a selective growth hormone secretagogue, to support advanced laboratory research into growth hormone regulation and metabolic signaling. This dual-peptide formulation allows researchers to investigate how GHRH receptor activation and ghrelin receptor stimulation work together to influence growth hormone release, cellular signaling, and metabolic function in controlled experimental models.

Each vial contains a total of 8 mg of peptide, consisting of 6 mg of Tesamorelin and 2 mg of Ipamorelin. This research blend is commonly used to study growth hormone pathways, body composition, tissue regeneration, recovery mechanisms, and metabolic processes in vitro and other preclinical research settings.

For laboratory research use only. Not intended for human or veterinary use.

Tesamorelin & Ipamorelin Blend Benefits

• Supports natural growth hormone release through complementary signaling pathways.
• May help reduce visceral (abdominal) fat in research models.
• Investigated for improving body composition while preserving lean muscle mass.
• May support muscle protein synthesis and tissue repair.
• Studied for enhancing post-workout recovery and physical performance.
• May promote connective tissue remodeling and recovery following injury.
• Investigated for improving metabolic health and glucose regulation.
• May support healthy sleep by enhancing the natural nighttime growth hormone pulse.
• Studied for increasing next-day energy and reducing exercise-related soreness.
• May improve endurance and recovery when combined with resistance training.
• Investigated for supporting healthy aging and growth hormone physiology.
• Studied for optimizing recovery during periods of reduced activity or rehabilitation.

Tesamorelin Ipamorelin Blend Dosage

Research protocols commonly investigate the Tesamorelin & Ipamorelin Blend as a single subcutaneous administration once daily, typically in the evening to align with the body’s natural growth hormone release during sleep.

Common research protocol:

• 1 injection daily
• Administered 30–90 minutes before bedtime
• Performed 2–3 hours after the last meal to minimize insulin interference with growth hormone release.
• Research cycles commonly range from 8–12 weeks, depending on the objectives of the study.

Because Tesamorelin and Ipamorelin remain investigational compounds outside of their approved indications, there is no universally established dosing protocol for this combination, and research methodologies may differ between studies.

Tesamorelin and Ipamorelin Peptide Structure

Tesamorelin

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

Synonyms:

• Tesamorelin acetate
• 901758-09-6
• TH9507
• UNII-LGW5H38VE3
• Tesamorelin acetate [USAN]

Ipamorelin

Sequence: Aib-His-D-2Nal-D-Phe-Lys

Molecular Formula: C₃₈H₄₉N₉O₅

Molecular Weight: 711.9 g/mol

PubChem CID: 9831659

CAS Number: 170851-70-4

Synonyms:

• 170851-70-4
• Ipamorelin [INN]
• NNC-26-0161
• UNII-Y9M3S784Z6